PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 204aa    MW: 23471.1 Da    PI: 5.0197
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026386genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.53.4e-3637120184
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                  aCaaCk++rrkCa+dC+lapyfp+ ++++f n+hklFG+sn++k++++l++ ++++am++++y+A++ra+dPv G++++i++ q
  DCAR_026386  37 ACAACKYQRRKCAPDCILAPYFPHLRQRQFLNAHKLFGVSNITKIIRNLEKYDKDEAMRTIIYQADVRASDPVGGCYRIIRDDQ 120
                  7******************************************************************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.11136137IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-3437121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MNNKNNNLET REITSNTPTP PPAATNNNIP RCNASQACAA CKYQRRKCAP DCILAPYFPH  60
LRQRQFLNAH KLFGVSNITK IIRNLEKYDK DEAMRTIIYQ ADVRASDPVG GCYRIIRDDQ  120
DRGQYILHGD DQVNFEEINS WGATENSATT LEVKRSYECE ENWEEDVNPK LLPYDRREEF  180
KIEAEEKSFD SVDDFRLKTT DAI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466020.19e-51PREDICTED: LOB domain-containing protein 22
STRINGPGSC0003DMT4000124986e-48(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.16e-44LOB domain-containing protein 22